Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255030.1 | 5prime_partial | 141 | 1-426(+) |
Amino Acid sequence : | |||
VSENRIVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTLALIPLLQLSPS PRIVNVSSSFGSLLLLWNKWA* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,355.586 | ||
Theoretical pI: | 5.420 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 32.246 | ||
aromaticity | 0.092 | ||
GRAVY | 0.198 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.248 | ||
sheet | 0.298 |