Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255033.1	internal	140	2-421(+)
Amino Acid sequence :
TDPASIAAVAVFIKSTFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFNALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVETNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSL LLLWNAWAKGVLGDEDRLTE
Physicochemical properties
Number of amino acids:		140
Molecular weight:		15,075.988
Theoretical pI:		4.609
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15470
Instability index:		35.556
aromaticity		0.086
GRAVY		0.027
Secondary Structure Fraction
Helix		0.329
turn		0.264
sheet		0.314