| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255040.1 | internal | 112 | 2-337(+) |
Amino Acid sequence : | |||
| GHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETVDSLYKYHDLVRWSSFVLRLADDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKMNAERV | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 13,019.559 | ||
| Theoretical pI: | 5.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 56.696 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.205 | ||
| sheet | 0.259 | ||