Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255041.1 | 5prime_partial | 150 | 2-454(+) |
Amino Acid sequence : | |||
GTRFFQILDLMAKDPVRVLVTGAAGQIGYALVPMIARGVMLGADQPVILHMLDIPPAAEALNGVKMELVDAAFPLLKGVVATTDAVEACTGVNIAVMVGGFPTKEGMEKKDVMSKNVSIY KSQASALEKYAAANCKVLVVANPAITMPLI* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 11,749.428 | ||
Theoretical pI: | 11.782 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 42.386 | ||
aromaticity | 0.071 | ||
GRAVY | 0.382 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.319 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255041.1 | complete | 113 | 357-16(-) |
Amino Acid sequence : | |||
METFLDITSFFSIPSFVGNPPTITAILTPVQASTASVVATTPLRRGNAASTNSILTPFSASAAGGISSMWRITGWSAPNITPLAIIGTRAYPICPAAPVTRTRTGSLAIRSRI* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,749.428 | ||
Theoretical pI: | 11.782 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 42.386 | ||
aromaticity | 0.071 | ||
GRAVY | 0.382 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.319 | ||
sheet | 0.212 |