| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255042.1 | internal | 110 | 2-331(+) |
Amino Acid sequence : | |||
| EQXTELIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKET | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,984.524 | ||
| Theoretical pI: | 4.568 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 62.573 | ||
| aromaticity | 0.147 | ||
| GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.183 | ||
| sheet | 0.239 | ||