Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255042.1 | internal | 110 | 2-331(+) |
Amino Acid sequence : | |||
EQXTELIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKET | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,984.524 | ||
Theoretical pI: | 4.568 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 62.573 | ||
aromaticity | 0.147 | ||
GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.183 | ||
sheet | 0.239 |