| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255043.1 | internal | 172 | 518-3(-) |
Amino Acid sequence : | |||
| FWLKEHYSGEVWDSHVCPGKTKAMAFNMIGCLTARSKEKCGSFQRIKESLGLKTPQIREQSQALVLCSSALFFAYKYFFQTFLAGKLLLWLFGLSSWESLPLTKWEPPFWLERPGSTLSP TELSSTKLHERSCMAGRIENSKNILSICKLLRVYPPIKLPHIPPKAIAIQEM | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 12,255.901 | ||
| Theoretical pI: | 9.359 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 49.883 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.315 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255043.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| SISWMAMAFGGICGSLIGGYTLNNLQMDKIFLLFSILPAIQLLSCSLVEESSVGDKVLPGRSSQNGGSHFVNGKDSHEDNPKSHNNNFPAKKVWKKYLYAKKRAEEHKTRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,255.901 | ||
| Theoretical pI: | 9.359 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 49.883 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.360 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.315 | ||
| sheet | 0.234 | ||