| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255044.1 | internal | 188 | 2-565(+) |
Amino Acid sequence : | |||
| LNIVQAHFQQELKESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYD VMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWMSISGPCMLTHIFFRVTDSFT | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 22,385.284 | ||
| Theoretical pI: | 4.905 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 52035 | ||
| Instability index: | 52.497 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.378 | ||
| turn | 0.170 | ||
| sheet | 0.245 | ||