| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255045.1 | 5prime_partial | 145 | 1-438(+) |
Amino Acid sequence : | |||
| TSGASPLSPDVMEFLRVCFGCQVIEGYGMTETSCVISSMDEGDNLTGHVGSPNPACEIKLVDVPEMSYTSEDQPHPRGEICVRGHIIFQGYYKDEVQTKEVVDDDGWLHTGDIGLWLPGG RLKIIDREKEHFPAGAGRIYCPREN* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 12,520.613 | ||
| Theoretical pI: | 9.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 42.655 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.202 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255045.1 | 3prime_partial | 109 | 281-607(+) |
Amino Acid sequence : | |||
| MKFRRKKWSMMTVGCIQEILDYGFQVGALRLSIGKKNIFQLAPGEYIAPEKIEKVFASVNLLHHAFVFRDSFNSRLIAVVCVDPEVLQDGPPRKTPLLRILDNYARIQN | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,520.613 | ||
| Theoretical pI: | 9.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 42.655 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.202 | ||
| sheet | 0.239 | ||