| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255046.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| GVDINDMKHKKARAFGVTDFVNPKKTDKSMSELIQEANGGVGVDYCVQCTGVPSLINEAIASTKMGLGEVVLISAGEESRTELHYVALLNGRTLPGPTVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,589.014 | ||
| Theoretical pI: | 5.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 34.012 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.260 | ||
| sheet | 0.250 | ||