| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255047.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
| QGSEIPSMPPACKVPDNCIIDTEMKAASACNDDVSAAVVENTGAPVSDAVDDNLNNGAEIGKIVGGKNESRMRYLDVDISRLLEERSRARELLKSCRPPISQASRRQKFKESLQKGLIDC KDVDVSFENFPYYLSETTKDVLIASSFIHLKCKKYKKFTSNLPTVCPRILLSGPG | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 19,226.767 | ||
| Theoretical pI: | 7.691 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 45.207 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.396 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.269 | ||
| sheet | 0.229 | ||