| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255049.1 | internal | 139 | 3-419(+) |
Amino Acid sequence : | |||
| KTHHRNPMSTLCVPPNVPSVAEDCEQLRKAFSGWGTNEDLIISILGRRNASQRKSIRQAYADTYGEDLLKALDKELSSDFERIVMVWALDPPERDAYLANEATKKWTSNSQIIAEIACTR SPKELLLAREAYHARFKKS | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,790.749 | ||
| Theoretical pI: | 8.478 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 45.519 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.209 | ||
| sheet | 0.295 | ||