| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255051.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
| LKVFSVATQMAIPSKLTRCLPPSHLKSSPKLLSSTNSSSRSRLRVYCSSSQLTTERRSGNYNPSRWDVEFIQSLHSDYKEFKHAIRASELITLVKMELEKETDLIRQLELIDDLPKMGAV RSFPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,283.267 | ||
| Theoretical pI: | 9.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 69.246 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.256 | ||
| sheet | 0.256 | ||