Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255051.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
LKVFSVATQMAIPSKLTRCLPPSHLKSSPKLLSSTNSSSRSRLRVYCSSSQLTTERRSGNYNPSRWDVEFIQSLHSDYKEFKHAIRASELITLVKMELEKETDLIRQLELIDDLPKMGAV RSFPQ* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,283.267 | ||
Theoretical pI: | 9.593 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 69.246 | ||
aromaticity | 0.064 | ||
GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.256 | ||
sheet | 0.256 |