Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255055.1 | 5prime_partial | 111 | 2-337(+) |
Amino Acid sequence : | |||
LGSXNVGDYVPWLSWINRINGVDAELEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTTFAALQWTMAELIKNPRSL* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,408.891 | ||
Theoretical pI: | 4.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 15.812 | ||
aromaticity | 0.082 | ||
GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.200 | ||
sheet | 0.245 |