| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255055.1 | 5prime_partial | 111 | 2-337(+) |
Amino Acid sequence : | |||
| LGSXNVGDYVPWLSWINRINGVDAELEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTTFAALQWTMAELIKNPRSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,408.891 | ||
| Theoretical pI: | 4.673 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 15.812 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.200 | ||
| sheet | 0.245 | ||