| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255060.1 | internal | 159 | 2-478(+) |
Amino Acid sequence : | |||
| EAPGNLLTGFGFYEPYWLVDIANICIVLHLVGGYQIYSQPLFAVAESHFSKKHPDSGFVNNEYRVKLPLLPHFRLNLLRLCFRTAYVASTTGLALLFPYFNEVLGVLGALNFWPLAIYFP VEMYLVQKKVRAWTSIWIVLQAFRIFCLLCTILAVYWIG | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 18,255.372 | ||
| Theoretical pI: | 8.712 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42650 | ||
| Instability index: | 25.219 | ||
| aromaticity | 0.176 | ||
| GRAVY | 0.616 | ||
Secondary Structure Fraction | |||
| Helix | 0.484 | ||
| turn | 0.201 | ||
| sheet | 0.277 | ||