Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255060.1	internal	159	2-478(+)
Amino Acid sequence :
EAPGNLLTGFGFYEPYWLVDIANICIVLHLVGGYQIYSQPLFAVAESHFSKKHPDSGFVNNEYRVKLPLLPHFRLNLLRLCFRTAYVASTTGLALLFPYFNEVLGVLGALNFWPLAIYFP VEMYLVQKKVRAWTSIWIVLQAFRIFCLLCTILAVYWIG
Physicochemical properties
Number of amino acids:		159
Molecular weight:		18,255.372
Theoretical pI:		8.712
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		42400 42650
Instability index:		25.219
aromaticity		0.176
GRAVY		0.616
Secondary Structure Fraction
Helix		0.484
turn		0.201
sheet		0.277