| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255067.1 | 5prime_partial | 132 | 2-400(+) |
Amino Acid sequence : | |||
| RRVDAILEAIVEEHKLKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMAELMRNPEVMAKAQAEVIAALKGKTNWDVDDLQELKFMKSVVKETMKM HPPIPLIPRSCR* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 12,669.762 | ||
| Theoretical pI: | 9.245 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 59.051 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.673 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.288 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255067.1 | 3prime_partial | 118 | 354-1(-) |
Amino Acid sequence : | |||
| MVSFTTDFMNFSSCRSSTSQFVFPFSAAITSACAFAITSGFLISSAITHRVVVDDVSVPAENVSKMKALMALVVMGTLIWLSFCILKSTSIMSSPPNSPLFLSLCSSTMASRMASTRR | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,669.762 | ||
| Theoretical pI: | 9.245 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 59.051 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.673 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.288 | ||
| sheet | 0.246 | ||