| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255068.1 | 5prime_partial | 168 | 3-509(+) |
Amino Acid sequence : | |||
| TQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPE PLSVFVDSYGTGKIPDKEILKILKGTFDFMPRMMSINLDLKKGSTGSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,138.556 | ||
| Theoretical pI: | 8.945 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 17.171 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.268 | ||
| sheet | 0.179 | ||