Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255071.1 | 5prime_partial | 190 | 2-574(+) |
Amino Acid sequence : | |||
DDVVVLTEENFATEVGQDRGALVEFYAPWCGHCKKLAPEFEKLGASFKKAKSVLIGKVDCDEHKTVCSKYGVSGYPTIQWFPKGSSEPKKYEGARTAEALTEFVNTEAGTNVKIAAIPSS VVVLTPDNFHXVVLDEKKDVLVEFYAPWCGHCKNLAPTYEKLAAAFNLEEKLSSLMLMLMHTRYWRKVWC* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,173.136 | ||
Theoretical pI: | 6.248 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38305 | ||
Instability index: | 26.520 | ||
aromaticity | 0.111 | ||
GRAVY | -0.180 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.190 | ||
sheet | 0.280 |