Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255079.1 | internal | 166 | 2-499(+) |
Amino Acid sequence : | |||
RAVVVSSSEVIKELFTTNDAAVSSRPSVKAGKHLAYDYAMLGFSSYGTYWRQMRKLVSLELFSARRVELQRNVRVSETAHFINELYIPWEEKKDGSNPVSVEMKELFGELNMNVILKNSG REAVPRGDYTEEARRCPPLLRNSSPPGVVRSVRNLPVPPVGGFWKA | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,715.193 | ||
Theoretical pI: | 9.584 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 52.373 | ||
aromaticity | 0.090 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.283 | ||
sheet | 0.259 |