Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255082.1 | internal | 159 | 3-479(+) |
Amino Acid sequence : | |||
THTNTVKMGEEKSNKQIILKDYVKGFPKESDMILKTSIVKLKIPEDLNGAVLVKNLYLSVDPYMRGRMGRGSSYIDSFTPGEFLNFICCCTGYSGIWSFENYGFFPFRFPKRLFGLGHNW LPGILFNQIHTISKQTSLAEVPLSYYTPIFEQENRIDLC | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,252.904 | ||
Theoretical pI: | 8.632 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 31.184 | ||
aromaticity | 0.138 | ||
GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.270 | ||
sheet | 0.189 |