Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255082.1	internal	159	3-479(+)
Amino Acid sequence :
THTNTVKMGEEKSNKQIILKDYVKGFPKESDMILKTSIVKLKIPEDLNGAVLVKNLYLSVDPYMRGRMGRGSSYIDSFTPGEFLNFICCCTGYSGIWSFENYGFFPFRFPKRLFGLGHNW LPGILFNQIHTISKQTSLAEVPLSYYTPIFEQENRIDLC
Physicochemical properties
Number of amino acids:		159
Molecular weight:		18,252.904
Theoretical pI:		8.632
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 23170
Instability index:		31.184
aromaticity		0.138
GRAVY		-0.185
Secondary Structure Fraction
Helix		0.358
turn		0.270
sheet		0.189