| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255084.1 | 3prime_partial | 149 | 68-514(+) |
Amino Acid sequence : | |||
| MGAGGRMSVPPESKKSKPERVPFTKPPFTLGEIKKAIPPHCFKRSVLRSFSYVVCDLTIASIFYHVATNYFHHLPHPFNYLXWTSTPFAKAVFSLEFGSLPTNVWHHAFSEYQWLDENVG LVLHSFLLVPYFSWESLTTVPTIQTRVLF | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,990.456 | ||
| Theoretical pI: | 9.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 48.320 | ||
| aromaticity | 0.162 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.378 | ||
| turn | 0.257 | ||
| sheet | 0.203 | ||