Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255087.1 | complete | 117 | 33-386(+) |
Amino Acid sequence : | |||
MVMNKQIVFNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEESELIWGSQAGWEEYTLIQNPYNLF* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,138.941 | ||
Theoretical pI: | 4.717 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 39.853 | ||
aromaticity | 0.103 | ||
GRAVY | 0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.376 | ||
turn | 0.299 | ||
sheet | 0.231 |