| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255094.1 | internal | 161 | 1-483(+) |
Amino Acid sequence : | |||
| ENRAKDNRRGEQNKSREMGLSDDQVASMKEAFNLFDADSDGKIAPSELGILMRSLGGNPTQAQLKSIIADEKLTAPFDFQRFLDLMSKHLKPEPFDRQLRDAFKVLDKDGTGFVVVKDLR HILTSIGEKLEQAEFDEWIREVDVGSDGKIKYEDFIARMVA | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 16,874.078 | ||
| Theoretical pI: | 5.134 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 68.218 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.123 | ||
| sheet | 0.370 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255094.1 | internal | 161 | 485-3(-) |
Amino Acid sequence : | |||
| LATMRAMKSSYLILPSDPTSTSRIHSSNSACSNFSPMLVRMCLRSFTTTKPVPSLSSTLNASRSWRSNGSGFKCFDMRSRNLWKSNGAVSFSSAIMDFNCACVGLPPRERISIPSSDGAI LPSLSASNKLNASFIDATWSSLSPISRDLFCSPLRLSFARF | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 16,874.078 | ||
| Theoretical pI: | 5.134 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 68.218 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.123 | ||
| sheet | 0.370 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255094.1 | 5prime_partial | 146 | 483-43(-) |
Amino Acid sequence : | |||
| GDHARDEILVFDLAIRSDINLSDPLVELRLLQFLADAGEDVPEILHYDEAGPVLVEHLERVAELAIKRLRLQVLRHEVEEPLEIERRGELLVGDYGFQLRLRRVAAEGTHQYPELRRRDF AVAIGVEQIERLLHRCYLVVAQPHFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 16,874.078 | ||
| Theoretical pI: | 5.134 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 68.218 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.123 | ||
| sheet | 0.370 | ||