Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255095.1 | internal | 167 | 3-503(+) |
Amino Acid sequence : | |||
RFGGPSNFPRGSSAFEDINSREALRFGEGSRPFNLSSELVRNPFRDGRFPPLPGHLGRGDIDDPGNLRFGEHRDPGFLHNQNGGDDGFGPDRPGHLMKGKFSGPGYISGHFNMGENAGPG NFPGQGRAGDVTGNFPRPPFSESIRADMPSFLRNNYPYHGMPNDSHF | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,242.707 | ||
Theoretical pI: | 6.719 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 36.902 | ||
aromaticity | 0.120 | ||
GRAVY | -0.949 | ||
Secondary Structure Fraction | |||
Helix | 0.210 | ||
turn | 0.455 | ||
sheet | 0.150 |