| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255095.1 | internal | 167 | 3-503(+) |
Amino Acid sequence : | |||
| RFGGPSNFPRGSSAFEDINSREALRFGEGSRPFNLSSELVRNPFRDGRFPPLPGHLGRGDIDDPGNLRFGEHRDPGFLHNQNGGDDGFGPDRPGHLMKGKFSGPGYISGHFNMGENAGPG NFPGQGRAGDVTGNFPRPPFSESIRADMPSFLRNNYPYHGMPNDSHF | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,242.707 | ||
| Theoretical pI: | 6.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 36.902 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.949 | ||
Secondary Structure Fraction | |||
| Helix | 0.210 | ||
| turn | 0.455 | ||
| sheet | 0.150 | ||