| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255096.1 | 5prime_partial | 156 | 2-472(+) |
Amino Acid sequence : | |||
| GGAKEHFFDALLSLKDKYDLSEDTIIGLLWDMITAGMDTTAITVEWAMAELIKNPRVQQKAQEELDRVIGYERVLTEPDFSNLPYLQCIAKEALRLHPPTPLMLPHRSNTNVKIGGYDIP KGSNVHVNVWAVARDPAVWKNASEFRPEKFLEEDLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,688.037 | ||
| Theoretical pI: | 5.078 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 29.673 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.199 | ||
| sheet | 0.301 | ||