Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255098.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
GLPHVNLGNLADKHGPIFGIRIGVHRAVVVSSSELVKELFTTNDTAVSSRPSVKAGKHLAYGYAMLGFSSYGAYWRQMRKLVSLELFSARRVELQRSVRVSETAHFINELYSAWEERRDG SGRVPVEMKELFGELSMNVILKMVAGKRF | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,698.082 | ||
Theoretical pI: | 9.919 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 36.097 | ||
aromaticity | 0.094 | ||
GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.248 | ||
sheet | 0.282 |