| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255098.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
| GLPHVNLGNLADKHGPIFGIRIGVHRAVVVSSSELVKELFTTNDTAVSSRPSVKAGKHLAYGYAMLGFSSYGAYWRQMRKLVSLELFSARRVELQRSVRVSETAHFINELYSAWEERRDG SGRVPVEMKELFGELSMNVILKMVAGKRF | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,698.082 | ||
| Theoretical pI: | 9.919 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 36.097 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.248 | ||
| sheet | 0.282 | ||