| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255100.1 | internal | 186 | 3-560(+) |
Amino Acid sequence : | |||
| QTASGQMIDLITTIEGEKDLSKYSLPLHRRIVQYKTAYYSFYLPVACALLMAGENLENHPTVKDVLIDMGIYFQVQDDYLDCFGEPEKIGKIGTDIEDFKCSWLVVKALELCNEEQKKTL FEHYGKENPADVAKIKALYNDINLQGMFADFESESYEKITSSIEAHPTNLCKHAPVFLGKDFPEAE | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 21,130.798 | ||
| Theoretical pI: | 4.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
| Instability index: | 36.196 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.299 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.183 | ||
| sheet | 0.285 | ||