| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255106.1 | internal | 170 | 3-512(+) |
Amino Acid sequence : | |||
| VIEDYPYAVDGLQIWSAISKWVEEYCSIYYTSDEAVQSDTELQSWWTEVREQAHGDKKDEPWWPKMQSRKELVDSCTIIIWIASALHAALNFGQYPFAGYMPNRPTVSRQLMPKPGSEDY EMLKTDPDRVFLKTITARLQTLLGIALIEILSRHSSDEVYLGQEGHARVD | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 13,201.813 | ||
| Theoretical pI: | 11.635 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.265 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.917 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.239 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255106.1 | 3prime_partial | 154 | 464-3(-) |
Amino Acid sequence : | |||
| MPRQDLDEGDPEQRLQPGGDGLQEHPVGIRFQHLVVFTPGFRHQLTADGGAVGHVPGERVLSEVESCMEGGGDPDDDGARVYELFAALHLGPPRLVFLVAMGLLPNLRPPGLELCVALYR LVRGVVDAAVFFHPFAYGGPNLEPVHRIGIVLDH | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 13,201.813 | ||
| Theoretical pI: | 11.635 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.265 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.917 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.239 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255106.1 | 5prime_partial | 117 | 2-355(+) |
Amino Acid sequence : | |||
| SDRGLSLCGGRAPDLVRHKQMGGRILQHLLHLGRGGTERHRAPILVDGGSGASPWRQERRAVVAQDAEPQRARRLVHHHHLDRLRPPCSSQLRTVPFRRVHAQPPHRQPSVDAETRE* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,201.813 | ||
| Theoretical pI: | 11.635 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 72.265 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.917 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.239 | ||
| sheet | 0.231 | ||