| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255110.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| RIGRLVARVALMSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKKDELTVKDSKTLLFGEKPVTVFGVRNPEEIPWGEAGAEYVVESTGVFTDQDKAAAHIKGGAKKVVISAPSKDAPM FVMGVNEKEYKNGINIVSNASCTTNCLAPLAKVLNDRFGIVEGLMTTVHAMTA | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,905.532 | ||
| Theoretical pI: | 5.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 29.286 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.202 | ||
| sheet | 0.254 | ||