| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255111.1 | internal | 150 | 1-450(+) |
Amino Acid sequence : | |||
| LQVAKKKLDNMLYVGLTENHKESANMFANVVGTQVISKHKVSSSDSDGAGNKSEKGSQLLSTKTDANDKDENTNPNLKNVSSTGTDNAVQENMTVGKLMEAYNSCVSPLRNSQTDRRANS LKQIHPVNFTKEARKQVPQGLLKEITSLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,361.123 | ||
| Theoretical pI: | 9.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 34.755 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.816 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.300 | ||
| sheet | 0.227 | ||