Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255111.1 | internal | 150 | 1-450(+) |
Amino Acid sequence : | |||
LQVAKKKLDNMLYVGLTENHKESANMFANVVGTQVISKHKVSSSDSDGAGNKSEKGSQLLSTKTDANDKDENTNPNLKNVSSTGTDNAVQENMTVGKLMEAYNSCVSPLRNSQTDRRANS LKQIHPVNFTKEARKQVPQGLLKEITSLRG | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,361.123 | ||
Theoretical pI: | 9.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 34.755 | ||
aromaticity | 0.027 | ||
GRAVY | -0.816 | ||
Secondary Structure Fraction | |||
Helix | 0.213 | ||
turn | 0.300 | ||
sheet | 0.227 |