| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255126.1 | internal | 138 | 2-415(+) |
Amino Acid sequence : | |||
| LWRMRRRVDTILEAIVDEHKFKKSGEFGGEDIIDVLFRMQKDTQIKVPITTNSIKAFIFDTFSAGTETSSTTTLWVLAELMRNPAVMAKAQAEVRAALKEKTNWDVDDVQELKYMKSVVK ETMRMHPPIPLIPRSCRE | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,821.248 | ||
| Theoretical pI: | 8.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 62.922 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.646 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.283 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255126.1 | internal | 138 | 414-1(-) |
Amino Acid sequence : | |||
| SLHDLGINGIGGCILIVSFTTDFMYLSSCTSSTSQFVFSFSAALTSACAFAITAGFLISSASTHRVVVEDVSVPAENVSKMKALMELVVMGTLIWVSFCILKRTSMMSSPPNSPLFLNLC SSTMASRMVSTRRRILQS | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,821.248 | ||
| Theoretical pI: | 8.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 62.922 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.646 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.283 | ||
| sheet | 0.254 | ||