Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255146.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
KIMELQISSAIIILVVTYTISLLIIKQWRKPKPQENLPPGPPKLPLIGHLHLLWGKLPQHALASVAKQYGPVAHVQLGEVFSVVLSSREATKEAMKLVDPACADRFDSIGTKIMWYDNDD IIFSPYSEHWRQMRKICVSELLSARNVRSFGFIRQDEVSRLLGQLRSSAAGGEAWTHGRIRPDCSIICRRVRELIRTQDCGLVKTL | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 11,258.704 | ||
Theoretical pI: | 9.211 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 65.968 | ||
aromaticity | 0.136 | ||
GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.340 | ||
sheet | 0.175 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255146.1 | 5prime_partial | 181 | 3-548(+) |
Amino Acid sequence : | |||
NNGASDFVGDYNPCSNLHHIPPNNQAMAKTETPREPASGPAEAAADRAPPPPMGEAAAARAGQRGEAVRARGPRAAGRGVLRRALVPRGHEGGDEAGGPGLRGPVRQHRDEDHVVRQRRH NLQPLQRALAPDAEDLRLRAPQRPQRPLLRLHPAGRSVPPPRAAPLLGRGGGSLDSRTDTT* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 11,258.704 | ||
Theoretical pI: | 9.211 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 65.968 | ||
aromaticity | 0.136 | ||
GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.340 | ||
sheet | 0.175 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255146.1 | 5prime_partial | 153 | 618-157(-) |
Amino Acid sequence : | |||
EGLYQSTVLCPDKFPNPPADDGAVRSYPSVSPGFPPRGRGAELPEEAGHFVLPDEAEGADVAGAEELGDADLPHLAPVLAVGAEDYVVVVVPHDLRPDAVEPVRAGRVHQLHRLLRGLAG REHDGEHLAQLHVGHGPVLLRHAGQRVLRQLPP* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 11,258.704 | ||
Theoretical pI: | 9.211 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 65.968 | ||
aromaticity | 0.136 | ||
GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.340 | ||
sheet | 0.175 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255146.1 | complete | 103 | 362-51(-) |
Amino Acid sequence : | |||
MSSLSYHMIFVPMLSNRSAQAGSTSFIASFVASRDESTTENTSPSCTWATGPYCFATLASACCGSFPHRRWRCPISGSFGGPGGRFSWGFGFRHCLIIRRDMV* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,258.704 | ||
Theoretical pI: | 9.211 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 65.968 | ||
aromaticity | 0.136 | ||
GRAVY | 0.005 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.340 | ||
sheet | 0.175 |