Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255148.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
DGGDDFNRILIKVIKLLGSFNVGDYVPWLSWINRINGVDAEVEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTTFAALEWTMAEL IKNPRTLKTLQNEVREVSINKGGITQDDFDKMPYLKAVSQEILRLHPPFAILLPRELTPDPICSATTSPLARSVGHTGAYQKPSFWKS | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 11,089.843 | ||
Theoretical pI: | 11.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 46.275 | ||
aromaticity | 0.088 | ||
GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.314 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255148.1 | complete | 102 | 546-238(-) |
Amino Acid sequence : | |||
MGSGVNSRGSRIAKGGCRRRISWDTAFRYGILSKSSWVIPPLFIETSRTSFCKVFRVRGFFMSSAIVHSRAAKVVSVPAETMSKIRALITSSSTGSVSLLSL* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,089.843 | ||
Theoretical pI: | 11.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 46.275 | ||
aromaticity | 0.088 | ||
GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.314 | ||
sheet | 0.176 |