Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255156.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
KFSRHELKGCINDAKCMKYLLINKFRFPESSILMLTEEETDPYRIPTKHNMRMALFWLLQGCQAGDSLVFHYSGHGSRQRNYNGDEVDGYDETLCPLDFETQGMIVDDEINASIVRPVPR GAKLHAIIDACHSGTVLDLPYLCRMSRSGQYVWEDHRPPSGVWKGSSGGESIPSVAVMMIKLLLIHLLYQNHF | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 21,975.997 | ||
Theoretical pI: | 6.312 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28795 | ||
Instability index: | 46.481 | ||
aromaticity | 0.093 | ||
GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.244 | ||
sheet | 0.244 |