Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255156.1	internal	193	1-579(+)
Amino Acid sequence :
KFSRHELKGCINDAKCMKYLLINKFRFPESSILMLTEEETDPYRIPTKHNMRMALFWLLQGCQAGDSLVFHYSGHGSRQRNYNGDEVDGYDETLCPLDFETQGMIVDDEINASIVRPVPR GAKLHAIIDACHSGTVLDLPYLCRMSRSGQYVWEDHRPPSGVWKGSSGGESIPSVAVMMIKLLLIHLLYQNHF
Physicochemical properties
Number of amino acids:		193
Molecular weight:		21,975.997
Theoretical pI:		6.312
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28420 28795
Instability index:		46.481
aromaticity		0.093
GRAVY		-0.282
Secondary Structure Fraction
Helix		0.311
turn		0.244
sheet		0.244