| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255164.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
| KYDMIPTENFVGEASSCQALFLQPHFYDKVEDKSIILKKSKSFTFCKEGIILDAEDSTPLQADVVIFATGYKGDEKLKNMFASPTFQEYIEGSSASVIPLYRQMIHPRIPQMAVIGYSES LSNIFTFEMRSKWVAEFLDETFRLPDMRAMEKEIEMWEKYMKRYAGNKMFRRACVGGVPIWFNDQICQRYWDRLRKGRKVLFRNFS | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 24,193.719 | ||
| Theoretical pI: | 8.586 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35660 | ||
| Instability index: | 48.087 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.363 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.194 | ||
| sheet | 0.243 | ||