| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255169.1 | internal | 205 | 2-616(+) |
Amino Acid sequence : | |||
| KVFSVATQMAIPSKLTRCLPPSHLKSSPKLLSSTNSSSRSRLRVYCSSSQLTTERRSGNYNPSRWDVEFIQSLHSDYEEDKHAIRASELVTLVKMELEKETDHIRQLELIDDLQRMGLSD HFQNEFKEILSSIYLDHHYYKNPFPKEERDLYSTSLAFRLLREHGFQVAQDYLTVSRTRRVNSKKALATTPEDCCNCMNFLSVDG | |||
Physicochemical properties | |||
| Number of amino acids: | 205 | ||
| Molecular weight: | 15,312.714 | ||
| Theoretical pI: | 6.411 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 52.318 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.195 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255169.1 | complete | 133 | 493-92(-) |
Amino Acid sequence : | |||
| MFSEEPKCKRCGVEIPFFFWKRVLVIVMVEIYRGQDFFELILEMIGQPHSLQVIDQLKLSNMIRFFLQFHLHQSDQLRSPNCVFVLLIITVEGLDEFDIPTRRVVVSGSSLSSELRGGAI HTEARPTTTVSAR* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,312.714 | ||
| Theoretical pI: | 6.411 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 52.318 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.195 | ||
| sheet | 0.233 | ||