| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255171.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
| VAAQEAADPFEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQAMAPGFKAYAKQVRANAVALGNYLMSKGYNLVTGGTE NHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGIRIGTPAMTSKGLVQKDFXQILNSPPNRDSPLKIQKEHGKL | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,290.290 | ||
| Theoretical pI: | 11.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 52.565 | ||
| aromaticity | 0.152 | ||
| GRAVY | 0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.182 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255171.1 | 5prime_partial | 100 | 617-315(-) |
Amino Acid sequence : | |||
| SLPCSFWIFKGLSRFGGEFRICXKSFWTNPFDVMAGVPMRIPPGAKALLSPNTAFLFTVMLHRSQSFSTLFPVSPRGRRSHKTKWFSVPPVTRLYPLLIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,290.290 | ||
| Theoretical pI: | 11.575 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 52.565 | ||
| aromaticity | 0.152 | ||
| GRAVY | 0.097 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.303 | ||
| sheet | 0.182 | ||