Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255200.1	internal	114	2-343(+)
Amino Acid sequence :
IPGVREPVREHRDEDHVVRQRGHHLQPLQRALAPDAQDLRLRAPLLPQRPLLRLHPAGRGVAPPPPPPLLGRGGRGHDGEDRDADVLHRLRGGVRERSSGTTRDLVGLVMDALI
Physicochemical properties
Number of amino acids:		114
Molecular weight:		13,046.695
Theoretical pI:		8.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		37470 37720
Instability index:		49.981
aromaticity		0.124
GRAVY		-0.216
Secondary Structure Fraction
Helix		0.319
turn		0.248
sheet		0.212

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255200.1	internal	113	3-341(+)
Amino Acid sequence :
YPACANRFESIGTRIMWYDNEDIIFSPYSEHWRQMRKICVSELLSSRNVRSFGFIRQDEVSRLLRHLRSSAGAAVDMTERIETLTCSIVCGAAFGSVHQGPRGIWWGWSWTLS
Physicochemical properties
Number of amino acids:		113
Molecular weight:		13,046.695
Theoretical pI:		8.506
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		37470 37720
Instability index:		49.981
aromaticity		0.124
GRAVY		-0.216
Secondary Structure Fraction
Helix		0.319
turn		0.248
sheet		0.212