Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255203.1 | 5prime_partial | 115 | 3-350(+) |
Amino Acid sequence : | |||
RVQASKAFKSIGVDKNLSDNALDKQKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELAMIWKGGCIIRAVFLDRIKKAYDRNPNLANLLVDPEFSRGGPVPNSPYN* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 11,785.752 | ||
Theoretical pI: | 9.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 49.209 | ||
aromaticity | 0.136 | ||
GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.282 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255203.1 | 3prime_partial | 103 | 265-573(+) |
Amino Acid sequence : | |||
MTGTRILLICSWIRSSRGGARYPIRPIIESYLQFTGPSCYNVVTWEKPLAFPNLFPLAAHPPFRPAGVITKEAPTDCLPNCCRNLNGKWQIYPLRFVEKFPFK | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,785.752 | ||
Theoretical pI: | 9.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 49.209 | ||
aromaticity | 0.136 | ||
GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.282 | ||
sheet | 0.194 |