| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255203.1 | 5prime_partial | 115 | 3-350(+) |
Amino Acid sequence : | |||
| RVQASKAFKSIGVDKNLSDNALDKQKLIDDVRQALYASKICSYAQGMNLIRAKSIEKGWDLKLGELAMIWKGGCIIRAVFLDRIKKAYDRNPNLANLLVDPEFSRGGPVPNSPYN* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,785.752 | ||
| Theoretical pI: | 9.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 49.209 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.282 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255203.1 | 3prime_partial | 103 | 265-573(+) |
Amino Acid sequence : | |||
| MTGTRILLICSWIRSSRGGARYPIRPIIESYLQFTGPSCYNVVTWEKPLAFPNLFPLAAHPPFRPAGVITKEAPTDCLPNCCRNLNGKWQIYPLRFVEKFPFK | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,785.752 | ||
| Theoretical pI: | 9.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 49.209 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.080 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.282 | ||
| sheet | 0.194 | ||