Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255204.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
DPPGCRNSARAIVGFGVSKIIDSSNSDFEKGDLVWGMTGWEEYSLIKSAQSLNKLPFAGDVRLSYYTGILGMPGMTAYAGFYHICSPMKGRKRLYIRSIRKPLVILFGQFC* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,320.200 | ||
Theoretical pI: | 9.438 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 46.789 | ||
aromaticity | 0.126 | ||
GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.297 | ||
sheet | 0.198 |