Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255207.1 | 5prime_partial | 144 | 1-435(+) |
Amino Acid sequence : | |||
QAPMADAQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARKKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFK ALQALEAGAKEEPPFKPKANWRND* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,787.004 | ||
Theoretical pI: | 8.014 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 22.904 | ||
aromaticity | 0.069 | ||
GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.201 | ||
sheet | 0.319 |