| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255207.1 | 5prime_partial | 144 | 1-435(+) |
Amino Acid sequence : | |||
| QAPMADAQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARKKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFK ALQALEAGAKEEPPFKPKANWRND* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,787.004 | ||
| Theoretical pI: | 8.014 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 22.904 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.201 | ||
| sheet | 0.319 | ||