| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255212.1 | internal | 113 | 340-2(-) |
Amino Acid sequence : | |||
| LSNSWNPHNMILRQEMADRKSSRRHLQHLKRQVLRVPRRRVRMADRYRIRLRSASPHQRHPVRRRGLRLVAVVHRVGVLLLVAHHHCLLARQPLHRRHSVRLPLRLVGGGRHR | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 10,675.346 | ||
| Theoretical pI: | 4.811 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 67.024 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.628 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.468 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255212.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
| AVSTAADKAERETYRVAAVKRLPSEKAVVVCHQQEYPYAVYYCHKTKTTAAYGVSLVGGGGTKADAVAVCHTDTAAWNPKHLAFQVLKVAPGTLPICHFLPENHVVWVPRIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 10,675.346 | ||
| Theoretical pI: | 4.811 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 67.024 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.628 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.468 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255212.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| RGVDRRRQGGEGDVPSGGGEEAAEREGSGGVPPAGVPLRGVLLPQDEDHGGVRGVAGGGRRNEGGCGSGLPYGHGGVEPEALGVSGAEGGAGNSSDLPFPAGESCCVGSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 10,675.346 | ||
| Theoretical pI: | 4.811 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 67.024 | ||
| aromaticity | 0.018 | ||
| GRAVY | -0.628 | ||
Secondary Structure Fraction | |||
| Helix | 0.162 | ||
| turn | 0.468 | ||
| sheet | 0.225 | ||