Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255214.1	5prime_partial	116	3-353(+)
Amino Acid sequence :
TAYKYGSSGQSSSTLALKRSLEKRKNLRTALLLVVLLGAGMVIGDGVVTPAMSVVSAVSGLEAAHARLSSGAVRLICCVILVGLFALQHSGTHKVGVLFAPVVCHLATINFWHWTV*
Physicochemical properties
Number of amino acids:		116
Molecular weight:		12,156.257
Theoretical pI:		9.942
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		40.736
aromaticity		0.060
GRAVY		0.723
Secondary Structure Fraction
Helix		0.379
turn		0.233
sheet		0.293