Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255217.1	internal	202	3-608(+)
Amino Acid sequence :
TNGVIHRAVLGRKGDGGDDFNRILIKVIKLLGSFNVGDYVPWLSWINRINGVDAEVEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGT DTTFAALEWTMAELIKNPRTLKTLQNEVREVSTNKGGITEDDVDEMPYLKPVSREIYSYIPPFRNSAPSQGGARYPNSAYSE
Physicochemical properties
Number of amino acids:		202
Molecular weight:		22,650.244
Theoretical pI:		5.124
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 26930
Instability index:		20.258
aromaticity		0.084
GRAVY		-0.497
Secondary Structure Fraction
Helix		0.307
turn		0.243
sheet		0.213