| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255218.1 | 3prime_partial | 199 | 18-614(+) |
Amino Acid sequence : | |||
| MELQISSAIIILVVTYTISLLIIKQWRKPKPQENLPPGPPKLPLIGQLHLLWGKLPQHALASVAKQYGPVAHVQLGEVFSVVLSSREATKEAMKLVDPACADRFDSIGTKIMWYDNDDII FSPYSEHWRQMRKICVSELLSARNVRSFGFIRQDEVSRLLGHLRSSAAAGEAVDLPERISTLNCSLICRAGFGKLDPGT | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 12,578.203 | ||
| Theoretical pI: | 8.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 62.505 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.122 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.313 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255218.1 | complete | 170 | 92-604(+) |
Amino Acid sequence : | |||
| MAKTETPREPASGPAEAAADRATPPPMGEAAAARAGQRGEAVRARGPRAAGRGVLRRALVPRGHEGGDEAGGPGLRGPVRQHRDEDHVVRQRRHNLQPLQRALAPDAEDLRLRAPQRPQR PLLRLHPAGRSVPAPRAPPLLGRGGGSRGPPGADFDAELLPHLQGGVRET* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 12,578.203 | ||
| Theoretical pI: | 8.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 62.505 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.122 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.313 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255218.1 | 5prime_partial | 148 | 614-168(-) |
Amino Acid sequence : | |||
| GSRIKFPEPRPADEGAVQRRNPLREVHGFPRRGRGAEVPEEPGHFVLPDEAEGADVAGAEELGDADLPHLAPVLAVGAEDYVVVVVPHDLRPDAVEPVRAGRVHQLHRLLRGLAGREHDG EHLAQLHVGHGPVLLRHAGQRVLRQLPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,578.203 | ||
| Theoretical pI: | 8.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 62.505 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.122 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.313 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255218.1 | complete | 115 | 373-26(-) |
Amino Acid sequence : | |||
| MSSLSYHMIFVPMLSNRSAQAGSTSFIASFVASRDESTTENTSPSCTWATGPYCFATLASACCGSFPHRRWSCPISGSFGGPGGRFSWGFGFRHCLIIRRDMVYVTTRIIIADEI* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,578.203 | ||
| Theoretical pI: | 8.663 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 62.505 | ||
| aromaticity | 0.130 | ||
| GRAVY | 0.122 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.313 | ||
| sheet | 0.174 | ||