| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255219.1 | internal | 202 | 1-606(+) |
Amino Acid sequence : | |||
| HKFVQINGLKIHVAEIGGESSPAVVFLHGFPEIWYSWRHQMTAVAEAGFRAIAPDYRGYGLSDPPPEPEKASYSDLVADLLALLDSLSIQKAFVIAKDFGARVAYLFALFHPERVRGVIT LGIPYLPTSPVSFGDHLPEGFYMSRWLKPGRAEADFGRLDNKTVVRNVYILFSRSEVPIAHEKQEIMDLLMPHSLPLGSQKK | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,573.732 | ||
| Theoretical pI: | 6.779 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 50.790 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.041 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.243 | ||
| sheet | 0.272 | ||