Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255219.1	internal	202	1-606(+)
Amino Acid sequence :
HKFVQINGLKIHVAEIGGESSPAVVFLHGFPEIWYSWRHQMTAVAEAGFRAIAPDYRGYGLSDPPPEPEKASYSDLVADLLALLDSLSIQKAFVIAKDFGARVAYLFALFHPERVRGVIT LGIPYLPTSPVSFGDHLPEGFYMSRWLKPGRAEADFGRLDNKTVVRNVYILFSRSEVPIAHEKQEIMDLLMPHSLPLGSQKK
Physicochemical properties
Number of amino acids:		202
Molecular weight:		22,573.732
Theoretical pI:		6.779
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		28420 28420
Instability index:		50.790
aromaticity		0.114
GRAVY		-0.041
Secondary Structure Fraction
Helix		0.351
turn		0.243
sheet		0.272