| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255227.1 | 5prime_partial | 140 | 3-425(+) |
Amino Acid sequence : | |||
| AIGADKAFGRDIVDAHYKACIFAGVNISGINGEVMPGQWEYQVGPSVGISAGDELWISRYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYSTKSMREEGGFEIIKKAIEKLGLRHKG AHCCLRRGQRASPHWKARDC* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,312.237 | ||
| Theoretical pI: | 7.897 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 39.456 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.250 | ||
| sheet | 0.221 | ||