Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255227.1 | 5prime_partial | 140 | 3-425(+) |
Amino Acid sequence : | |||
AIGADKAFGRDIVDAHYKACIFAGVNISGINGEVMPGQWEYQVGPSVGISAGDELWISRYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYSTKSMREEGGFEIIKKAIEKLGLRHKG AHCCLRRGQRASPHWKARDC* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,312.237 | ||
Theoretical pI: | 7.897 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
Instability index: | 39.456 | ||
aromaticity | 0.086 | ||
GRAVY | -0.302 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.250 | ||
sheet | 0.221 |