| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255229.1 | 5prime_partial | 183 | 1-552(+) |
Amino Acid sequence : | |||
| GKALKGGMREKVQLATKFGIIMGDGKSDVRGDPAYVRSACESSLKRLDVDCIDLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIRRAHAVHPITAVQLEWSLWSRDVEQ EIIPTCRELGIGIXPYSPLGRGFLSLGPKLLENAAEGDLRKDFFPKFQGDNLETNKLVYEEDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 20,265.046 | ||
| Theoretical pI: | 5.718 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 33.074 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.225 | ||
| sheet | 0.269 | ||