Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255244.1 | 5prime_partial | 144 | 592-158(-) |
Amino Acid sequence : | |||
TKLVSSSPTFFLLYFGEYLPLIHPNLYRFFHFGIDAIXPVDPRQPWNVIPHVETSQELDNLDQNPIKIISRRRPSALTPPCELTPFVSAMNISLKFTTVVGFDRLIFSIIADVSSSRIPP NDWTLLALSSCSMHMLRALRQCSP* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 14,880.179 | ||
Theoretical pI: | 10.573 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 60.436 | ||
aromaticity | 0.075 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.246 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255244.1 | 5prime_partial | 134 | 3-407(+) |
Amino Acid sequence : | |||
LLHFGSAPVLVASSAAAAREIMKNQDVIFASRPRLSIFDRLMYSGKGVAFAPYGEHWRNARSMCMLQLLSAKRVQSFGGIREEETSAMIEKIRRSKPTTVVNLSEMFMALTNGVNSQGGV RAEGRRREMILIGF* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,880.179 | ||
Theoretical pI: | 10.573 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 60.436 | ||
aromaticity | 0.075 | ||
GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.246 | ||
sheet | 0.313 |