| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255244.1 | 5prime_partial | 144 | 592-158(-) |
Amino Acid sequence : | |||
| TKLVSSSPTFFLLYFGEYLPLIHPNLYRFFHFGIDAIXPVDPRQPWNVIPHVETSQELDNLDQNPIKIISRRRPSALTPPCELTPFVSAMNISLKFTTVVGFDRLIFSIIADVSSSRIPP NDWTLLALSSCSMHMLRALRQCSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 14,880.179 | ||
| Theoretical pI: | 10.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 60.436 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.246 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255244.1 | 5prime_partial | 134 | 3-407(+) |
Amino Acid sequence : | |||
| LLHFGSAPVLVASSAAAAREIMKNQDVIFASRPRLSIFDRLMYSGKGVAFAPYGEHWRNARSMCMLQLLSAKRVQSFGGIREEETSAMIEKIRRSKPTTVVNLSEMFMALTNGVNSQGGV RAEGRRREMILIGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,880.179 | ||
| Theoretical pI: | 10.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 60.436 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.062 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.246 | ||
| sheet | 0.313 | ||