Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255250.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
LIGALPGALTDPTPIHPSGETPADLAASNGHKGIAGYLAESSLSSHLSTLDLKESGQSDGGEKLVETISGRIATPVGAGDLLHGLSMKDSLAAVVMQLKLQLAFIKSSEYSRFKGNKLKE YGDSEFGISDERAVSLLARKTKKAGGKHDEPVIL | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 12,715.308 | ||
Theoretical pI: | 5.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 82.521 | ||
aromaticity | 0.094 | ||
GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.350 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255250.1 | 5prime_partial | 117 | 462-109(-) |
Amino Acid sequence : | |||
SMTGSSCFPPAFLVFLAKSETARSSDIPNSLSPYSFNLFPLKRLYSEDLMNASCSLSCITTAAKESFIESPWSKSPAPTGVAILPDIVSTSFSPPSLCPDSLRSRVDRWELKEDSAK* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,715.308 | ||
Theoretical pI: | 5.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 82.521 | ||
aromaticity | 0.094 | ||
GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.350 | ||
sheet | 0.248 |