| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255250.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| LIGALPGALTDPTPIHPSGETPADLAASNGHKGIAGYLAESSLSSHLSTLDLKESGQSDGGEKLVETISGRIATPVGAGDLLHGLSMKDSLAAVVMQLKLQLAFIKSSEYSRFKGNKLKE YGDSEFGISDERAVSLLARKTKKAGGKHDEPVIL | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 12,715.308 | ||
| Theoretical pI: | 5.325 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 82.521 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.350 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255250.1 | 5prime_partial | 117 | 462-109(-) |
Amino Acid sequence : | |||
| SMTGSSCFPPAFLVFLAKSETARSSDIPNSLSPYSFNLFPLKRLYSEDLMNASCSLSCITTAAKESFIESPWSKSPAPTGVAILPDIVSTSFSPPSLCPDSLRSRVDRWELKEDSAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,715.308 | ||
| Theoretical pI: | 5.325 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 82.521 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.350 | ||
| sheet | 0.248 | ||