| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255254.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
| EIEVDMVMNKQIVFNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYN LFKIQDKDVPLSYYVGILGMPGMTAYAGFFEICSPKKGETVFVTAAPGSVGPLVGHFAKSFGVLCCWNCREQKKG* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,507.668 | ||
| Theoretical pI: | 5.705 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31775 | ||
| Instability index: | 34.137 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.282 | ||
| sheet | 0.215 | ||