Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255254.1 | 5prime_partial | 195 | 2-589(+) |
Amino Acid sequence : | |||
EIEVDMVMNKQIVFNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYN LFKIQDKDVPLSYYVGILGMPGMTAYAGFFEICSPKKGETVFVTAAPGSVGPLVGHFAKSFGVLCCWNCREQKKG* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,507.668 | ||
Theoretical pI: | 5.705 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31775 | ||
Instability index: | 34.137 | ||
aromaticity | 0.108 | ||
GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.282 | ||
sheet | 0.215 |